Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL47 Rabbit Polyclonal Antibody (HRP)

MRPL47 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NCM1, L47mt, CGI-204, MRP-L47

UniProt

Q9HD33

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MRPL47

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VVQEREDALRLLQTGQERARPGAWRRDIFGRIIWHKFKQWVIPWHLNKRY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_817125

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Nr3c1 shRNA (UAS) - Lentiviral mouse Nr3c1 shRNA (UAS, GFP) (100)
GTR15191949 1 Vial

Lentiviral mouse Nr3c1 shRNA (UAS) - Lentiviral mouse Nr3c1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
HARS2 Polyclonal Antibody, Biotin Conjugated
A54589-100 100 µL

HARS2 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
PGC1α/β Antibody [H5N22]
C15816-100uL*2 2x 100μL

PGC1α/β Antibody [H5N22]

Sign In for Pricing
View Details
Rabbit anti-GGA1 Antibody, Affinity Purified
MBS3905502-01 0.01 mg

Rabbit anti-GGA1 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-GGA1 Antibody, Affinity Purified
MBS3905502-02 0.1 mg

Rabbit anti-GGA1 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-GGA1 Antibody, Affinity Purified
MBS3905502-03 5x 0.01 mg

Rabbit anti-GGA1 Antibody, Affinity Purified

Sign In for Pricing
View Details