Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL47 Rabbit Polyclonal Antibody (HRP)

MRPL47 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NCM1, L47mt, CGI-204, MRP-L47

UniProt

Q9HD33

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MRPL47

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VVQEREDALRLLQTGQERARPGAWRRDIFGRIIWHKFKQWVIPWHLNKRY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_817125

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGKV2-24 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV764939 1.0 µg DNA

IGKV2-24 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Olfr983 ORF Vector (Mouse) (pORF)
ORF053075 1.0 µg DNA

Olfr983 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
CSDE1 Antibody
orb2808278 100 µL

CSDE1 Antibody

Sign In for Pricing
View Details
Pno1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6085307 1.0 µg DNA

Pno1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
INPP5A (Type I Inositol 1,4,5-trisphosphate 5-phosphatase, 5PTase, DKFZp434A1721, MGC116947, MGC116949) (MaxLight 750) discontinued
128526-ML750 100 µL

INPP5A (Type I Inositol 1,4,5-trisphosphate 5-phosphatase, 5PTase, DKFZp434A1721, MGC116947, MGC116949) (MaxLight 750) discontinued

Sign In for Pricing
View Details
GENLISA™ Human C-C Chemokine Receptor Type 9 (CCR9) ELISA
KBH5000 96 Well

GENLISA™ Human C-C Chemokine Receptor Type 9 (CCR9) ELISA

Sign In for Pricing
View Details