Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP2R5C Rabbit Polyclonal Antibody (Biotin)

PPP2R5C Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

B56G, PR61G, B56gamma

UniProt

Q96B13

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PPP2R5C

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGK

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_848703

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Glipr1l1 Pre-designed siRNA Set B
SI105478B 1 Each

Mouse Glipr1l1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Dmc1 Polyclonal Antibody
UB-GEN-367 100 µL

Dmc1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal CTLA-4 Antibody (2188A) [Allophycocyanin/Cy7]
FAB3252APCCY7 0.1 mL

Rabbit Monoclonal CTLA-4 Antibody (2188A) [Allophycocyanin/Cy7]

Sign In for Pricing
View Details
Phospho-Beta Catenin (Thr41 + Ser45) Rabbit Polyclonal Antibody (Cy5)
orb903462 100 µL

Phospho-Beta Catenin (Thr41 + Ser45) Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Gab2 Rat shRNA Lentiviral Particle (Locus ID 84477)
TL711842V 500 µL Each

Gab2 Rat shRNA Lentiviral Particle (Locus ID 84477)

Sign In for Pricing
View Details
Defb46 (NM_001025351) Mouse Tagged Lenti ORF Clone
MR219585L4 10 µg

Defb46 (NM_001025351) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details