Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP2R5C Rabbit Polyclonal Antibody (HRP)

PPP2R5C Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

B56G, PR61G, B56gamma

UniProt

Q96B13

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PPP2R5C

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGK

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_848703

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human MYLK4 sgRNA gene knockout kit - Lentiviral human MYLK4 sgRNA gene knockout kit (100)
GTR15386812 1 Vial

Lentiviral human MYLK4 sgRNA gene knockout kit - Lentiviral human MYLK4 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Lentiviral human CDC40 sgRNA gene knockout kit - Lentiviral human CDC40 sgRNA gene knockout kit (plasmid)
GTR15395063 1 Vial

Lentiviral human CDC40 sgRNA gene knockout kit - Lentiviral human CDC40 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
PDE4C discontinued
540826-01 30ul

PDE4C discontinued

Sign In for Pricing
View Details
PDE4C discontinued
540826-02 100 µL

PDE4C discontinued

Sign In for Pricing
View Details
RBBP8, CT (RBBP8, CTIP, DNA endonuclease RBBP8, CtBP-interacting protein, Retinoblastoma-binding protein 8, Retinoblastoma-interacting protein and myosin-like, Sporulation in the absence of SPO11 protein 2 homolog) (MaxLight 405)
MBS6340624-01 0.1 mL

RBBP8, CT (RBBP8, CTIP, DNA endonuclease RBBP8, CtBP-interacting protein, Retinoblastoma-binding protein 8, Retinoblastoma-interacting protein and myosin-like, Sporulation in the absence of SPO11 protein 2 homolog) (MaxLight 405)

Sign In for Pricing
View Details
RBBP8, CT (RBBP8, CTIP, DNA endonuclease RBBP8, CtBP-interacting protein, Retinoblastoma-binding protein 8, Retinoblastoma-interacting protein and myosin-like, Sporulation in the absence of SPO11 protein 2 homolog) (MaxLight 405)
MBS6340624-02 5x 0.1 mL

RBBP8, CT (RBBP8, CTIP, DNA endonuclease RBBP8, CtBP-interacting protein, Retinoblastoma-binding protein 8, Retinoblastoma-interacting protein and myosin-like, Sporulation in the absence of SPO11 protein 2 homolog) (MaxLight 405)

Sign In for Pricing
View Details