Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP2R5D Rabbit Polyclonal Antibody (HRP)

PPP2R5D Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

B56D, MRD35, B56delta

UniProt

Q14738

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PPP2R5D

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEA

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006236

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT5B (Signal Transducer and Activator of Transcription 5B, STAT5) (MaxLight 490)
MBS6208755-01 0.1 mL

STAT5B (Signal Transducer and Activator of Transcription 5B, STAT5) (MaxLight 490)

Sign In for Pricing
View Details
STAT5B (Signal Transducer and Activator of Transcription 5B, STAT5) (MaxLight 490)
MBS6208755-02 5x 0.1 mL

STAT5B (Signal Transducer and Activator of Transcription 5B, STAT5) (MaxLight 490)

Sign In for Pricing
View Details
DLL3, CT (DLL3, Delta-like protein 3, Drosophila Delta homolog 3) (MaxLight 405)
MBS6292371-01 0.1 mL

DLL3, CT (DLL3, Delta-like protein 3, Drosophila Delta homolog 3) (MaxLight 405)

Sign In for Pricing
View Details
DLL3, CT (DLL3, Delta-like protein 3, Drosophila Delta homolog 3) (MaxLight 405)
MBS6292371-02 5x 0.1 mL

DLL3, CT (DLL3, Delta-like protein 3, Drosophila Delta homolog 3) (MaxLight 405)

Sign In for Pricing
View Details
ESYT2 Antibody
orb416755-01 50 µg

ESYT2 Antibody

Sign In for Pricing
View Details
ESYT2 Antibody
orb416755-02 100 µg

ESYT2 Antibody

Sign In for Pricing
View Details