Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Scyl3 Rabbit Polyclonal Antibody (HRP)

Scyl3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Pac, Pace1, AW214499, 6030457O16, 1200016D23Rik

UniProt

Q9DBQ7

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NGLSDVKNTSEDNGSFPAGSNKPEEWPDWSEPEEPEQQPASIHRWPREPC

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

81kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_083052

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Chemokine C-C-Motif Receptor 4 (CCR4) Protein
abx652868-01 10 µg

Human Chemokine C-C-Motif Receptor 4 (CCR4) Protein

Sign In for Pricing
View Details
Human Chemokine C-C-Motif Receptor 4 (CCR4) Protein
abx652868-02 50 µg

Human Chemokine C-C-Motif Receptor 4 (CCR4) Protein

Sign In for Pricing
View Details
Human Chemokine C-C-Motif Receptor 4 (CCR4) Protein
abx652868-03 100 µg

Human Chemokine C-C-Motif Receptor 4 (CCR4) Protein

Sign In for Pricing
View Details
Human Chemokine C-C-Motif Receptor 4 (CCR4) Protein
abx652868-04 200 µg

Human Chemokine C-C-Motif Receptor 4 (CCR4) Protein

Sign In for Pricing
View Details
Human Chemokine C-C-Motif Receptor 4 (CCR4) Protein
abx652868-05 500 µg

Human Chemokine C-C-Motif Receptor 4 (CCR4) Protein

Sign In for Pricing
View Details
Anti-Hsp20 Rabbit Monoclonal Antibody
MA3118-.05 50 µL

Anti-Hsp20 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details