Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PKM2 Rabbit Polyclonal Antibody (HRP)

PKM2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PK3, TCB, p58, OIP3, PKM2, CTHBP, THBP1, HEL-S-30

UniProt

P11980

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PKM2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HLQLFEELRRLAPITSDPTEATAVGAVEASFKCCSGAIIVLTKSGRSAHQ

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002645

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GRK3 Antibody Picoband®, iFluor647 Conjugate
A32254-1-iFluor647 100 µg

Anti-GRK3 Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
ERICH1 Protein Vector (Rat) (pPB-C-His)
PV266538 500 ng

ERICH1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Rabbit anti-human signal-regulatory protein alpha polyclonal Antibody
MBS714062-01 0.1 mL

Rabbit anti-human signal-regulatory protein alpha polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human signal-regulatory protein alpha polyclonal Antibody
MBS714062-02 5x 0.1 mL

Rabbit anti-human signal-regulatory protein alpha polyclonal Antibody

Sign In for Pricing
View Details
PGK1 Rabbit pAb, IRDye 800CW conjugated
orb2860011 100 µL

PGK1 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
Recombinant UPF0761 membrane protein YPO0028/y3801/YP_0029 (YPO0028, y3801, YP_0029)
orb2907070-01 20 µg

Recombinant UPF0761 membrane protein YPO0028/y3801/YP_0029 (YPO0028, y3801, YP_0029)

Sign In for Pricing
View Details