Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLRX2 Rabbit Polyclonal Antibody (Biotin)

GLRX2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

GRX2, CGI-133

UniProt

Q9NS18

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GLRX2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_932066

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ly6e shRNA (UAS) - Lentiviral mouseLy6e shRNA (UAS, GFP) (25)
GTR15242480 1 Vial

Lentiviral mouse Ly6e shRNA (UAS) - Lentiviral mouseLy6e shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
LPGAT1 (Lysophosphatidylglycerol Acyltransferase 1, FAM34A, FAM34A1, NET8)
248308 50 µL

LPGAT1 (Lysophosphatidylglycerol Acyltransferase 1, FAM34A, FAM34A1, NET8)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Collagen Type VI Alpha 3 (COL6a3)
MBS2063603-01 0.1 mL

PE-Linked Polyclonal Antibody to Collagen Type VI Alpha 3 (COL6a3)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Collagen Type VI Alpha 3 (COL6a3)
MBS2063603-02 0.2 mL

PE-Linked Polyclonal Antibody to Collagen Type VI Alpha 3 (COL6a3)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Collagen Type VI Alpha 3 (COL6a3)
MBS2063603-03 0.5 mL

PE-Linked Polyclonal Antibody to Collagen Type VI Alpha 3 (COL6a3)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Collagen Type VI Alpha 3 (COL6a3)
MBS2063603-04 1 mL

PE-Linked Polyclonal Antibody to Collagen Type VI Alpha 3 (COL6a3)

Sign In for Pricing
View Details