Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLRX2 Rabbit Polyclonal Antibody (HRP)

GLRX2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GRX2, CGI-133

UniProt

Q9NS18

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GLRX2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_932066

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MN (Metanephrine) Rabbit ELISA Kit
F0722 96 Tests

MN (Metanephrine) Rabbit ELISA Kit

Sign In for Pricing
View Details
ASH2L (Ash2 (Absent, Small, or Homeotic) -like (Drosophila), ASH2, ASH2L1, ASH2L2, Bre2) (AP) discontinued
243548-AP 100 µL

ASH2L (Ash2 (Absent, Small, or Homeotic) -like (Drosophila), ASH2, ASH2L1, ASH2L2, Bre2) (AP) discontinued

Sign In for Pricing
View Details
Cryo Gloves, Wrist S - 1 Pair - ABDOS
U20307 1 Each

Cryo Gloves, Wrist S - 1 Pair - ABDOS

Sign In for Pricing
View Details
TTC21B Antibody
DF15166-01 100 µL

TTC21B Antibody

Sign In for Pricing
View Details
TTC21B Antibody
DF15166-02 200 µL

TTC21B Antibody

Sign In for Pricing
View Details
Monkey Ras-Related Protein R-Ras2 (RRAS2) ELISA Kit
MBS9923003-01 48 Well

Monkey Ras-Related Protein R-Ras2 (RRAS2) ELISA Kit

Sign In for Pricing
View Details