Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINB8 Rabbit Polyclonal Antibody (FITC)

SERPINB8 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PI8, CAP2, PI-8, PSS5, C18orf53

UniProt

P50452

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SERPINB8

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KAWTNSEKLTKSKVQVFLPRLKLEESYDLEPFLRRLGMIDAFDEAKADFS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_942130

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Zaire ebolavirus Membrane-associated protein VP24 (VP24)
CSB-EP522532ZAS-01 20 µg

Recombinant Zaire ebolavirus Membrane-associated protein VP24 (VP24)

Sign In for Pricing
View Details
Recombinant Zaire ebolavirus Membrane-associated protein VP24 (VP24)
CSB-EP522532ZAS-02 100 µg

Recombinant Zaire ebolavirus Membrane-associated protein VP24 (VP24)

Sign In for Pricing
View Details
Recombinant Zaire ebolavirus Membrane-associated protein VP24 (VP24)
CSB-EP522532ZAS-03 1 mg

Recombinant Zaire ebolavirus Membrane-associated protein VP24 (VP24)

Sign In for Pricing
View Details
CCT8 Rabbit Polyclonal Antibody
orb513765 100 µg

CCT8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ABTB1 Rabbit Polyclonal Antibody
orb77621 100 µg

ABTB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue, Total Protein, Human Disease, Alzheimer's Disease, Brain, Postcentral Gyrus HisTekTM
T5595-6639 1 mg

Tissue, Total Protein, Human Disease, Alzheimer's Disease, Brain, Postcentral Gyrus HisTekTM

Sign In for Pricing
View Details