Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINB8 Rabbit Polyclonal Antibody (HRP)

SERPINB8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PI8, CAP2, PI-8, PSS5, C18orf53

UniProt

P50452

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SERPINB8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KAWTNSEKLTKSKVQVFLPRLKLEESYDLEPFLRRLGMIDAFDEAKADFS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_942130

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC675296 3'UTR GFP Stable Cell Line
TU162496 1.0 mL

LOC675296 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
MRPS11P1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
30524111 3x 1.0 µg

MRPS11P1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
C1qc sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3216505 3x 1.0 µg

C1qc sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Lentiviral human SESN2 shRNA (UAS) - Lentiviral human SESN2 shRNA (UAS, iRFP) (100)
GTR15146331 1 Vial

Lentiviral human SESN2 shRNA (UAS) - Lentiviral human SESN2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Sodium 2-chloro-5-nitrobenzenesulphonate
OR22597-01 100 mg

Sodium 2-chloro-5-nitrobenzenesulphonate

Sign In for Pricing
View Details
Sodium 2-chloro-5-nitrobenzenesulphonate
OR22597-02 500 mg

Sodium 2-chloro-5-nitrobenzenesulphonate

Sign In for Pricing
View Details