Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fam170b Rabbit Polyclonal Antibody (Biotin)

Fam170b Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AI449756, 4922501K12Rik

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QQPVEEEQSLSDSSECTRLLTKVLPWQQQPQQQPQEQQKQQQQQQQKQRQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001157957

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNX6 Rabbit Polyclonal Antibody
TA372346 100 µL

SNX6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GATC Human qPCR Primer Pair (NM_176818)
HP218701 200 Reactions

GATC Human qPCR Primer Pair (NM_176818)

Sign In for Pricing
View Details
Band 3 (SLC4A1) Rabbit Monoclonal Antibody
TA423610 100 µL

Band 3 (SLC4A1) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
EIF4E Rabbit Polyclonal Antibody
AP20976PU-N 100 µg

EIF4E Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS642327 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Mpg Rabbit Polyclonal Antibody
TA362879 100 µL

Mpg Rabbit Polyclonal Antibody

Sign In for Pricing
View Details