Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fam170b Rabbit Polyclonal Antibody (HRP)

Fam170b Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AI449756, 4922501K12Rik

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QQPVEEEQSLSDSSECTRLLTKVLPWQQQPQQQPQEQQKQQQQQQQKQRQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001157957

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human GGPS1 Protein (His Tag)
PKSH032484-01 10 µg

Recombinant Human GGPS1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human GGPS1 Protein (His Tag)
PKSH032484-02 50 µg

Recombinant Human GGPS1 Protein (His Tag)

Sign In for Pricing
View Details
CoCoA (CALCOCO1) Rabbit Polyclonal Antibody
TA374213 100 µL

CoCoA (CALCOCO1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ANKRD26P1 Antibody
KC-2953-01 50 μL

ANKRD26P1 Antibody

Sign In for Pricing
View Details
ANKRD26P1 Antibody
KC-2953-02 100 µL

ANKRD26P1 Antibody

Sign In for Pricing
View Details
ANKRD26P1 Antibody
KC-2953-03 1 mL

ANKRD26P1 Antibody

Sign In for Pricing
View Details