Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INKA2 Rabbit Polyclonal Antibody (Biotin)

INKA2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Fam212b, RGD1306526

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DNVFADLVGNWLDLPELEKGGERGETGGSGEPKGEKGQSRELGRKFALTA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001101183

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPL10 antibody
70R-33889 0.1 mg

MRPL10 antibody

Sign In for Pricing
View Details
TMED6, ID (TMED6, Transmembrane emp24 domain-containing protein 6, p24 family protein gamma-5) (FITC)
MBS6356265-01 0.2 mL

TMED6, ID (TMED6, Transmembrane emp24 domain-containing protein 6, p24 family protein gamma-5) (FITC)

Sign In for Pricing
View Details
TMED6, ID (TMED6, Transmembrane emp24 domain-containing protein 6, p24 family protein gamma-5) (FITC)
MBS6356265-02 5x 0.2 mL

TMED6, ID (TMED6, Transmembrane emp24 domain-containing protein 6, p24 family protein gamma-5) (FITC)

Sign In for Pricing
View Details
S200 Plate Adapter high profile
E5392070011 1 Each

S200 Plate Adapter high profile

Sign In for Pricing
View Details
Recombinant Human CD125/IL5RA Protein, N-His
orb2834175-01 20 µg

Recombinant Human CD125/IL5RA Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CD125/IL5RA Protein, N-His
orb2834175-02 50 µg

Recombinant Human CD125/IL5RA Protein, N-His

Sign In for Pricing
View Details