Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INKA2 Rabbit Polyclonal Antibody (Biotin)

INKA2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FAM212B, C1orf183

UniProt

Q9NTI7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C1orf183

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GDNVFADLVGNWLDLPELEKGGEKGETGGAREPKGEKGQPQELGRRFALT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human

Tested Applications

WB

NCBI Accession Number

NP_945120

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VILIP3, NT (Visinin-like Protein 3, Calcium-binding Protein BDR-1, HLP2, Hippocalcin-like Protein 1, HPCAL1, BDR1) (MaxLight 750)
MBS6505858-01 0.1 mL

VILIP3, NT (Visinin-like Protein 3, Calcium-binding Protein BDR-1, HLP2, Hippocalcin-like Protein 1, HPCAL1, BDR1) (MaxLight 750)

Sign In for Pricing
View Details
VILIP3, NT (Visinin-like Protein 3, Calcium-binding Protein BDR-1, HLP2, Hippocalcin-like Protein 1, HPCAL1, BDR1) (MaxLight 750)
MBS6505858-02 5x 0.1 mL

VILIP3, NT (Visinin-like Protein 3, Calcium-binding Protein BDR-1, HLP2, Hippocalcin-like Protein 1, HPCAL1, BDR1) (MaxLight 750)

Sign In for Pricing
View Details
ESYT1, CT (ESYT1, FAM62A, KIAA0747, MBC2, Extended synaptotagmin-1, Membrane-bound C2 domain-containing protein) (PE) discontinued
035245-PE 200 µL

ESYT1, CT (ESYT1, FAM62A, KIAA0747, MBC2, Extended synaptotagmin-1, Membrane-bound C2 domain-containing protein) (PE) discontinued

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Ribonuclease L (RNASEL)
MBS2070353-01 0.1 mL

FITC-Linked Polyclonal Antibody to Ribonuclease L (RNASEL)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Ribonuclease L (RNASEL)
MBS2070353-02 0.2 mL

FITC-Linked Polyclonal Antibody to Ribonuclease L (RNASEL)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Ribonuclease L (RNASEL)
MBS2070353-03 0.5 mL

FITC-Linked Polyclonal Antibody to Ribonuclease L (RNASEL)

Sign In for Pricing
View Details