Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prcc Rabbit Polyclonal Antibody (HRP)

Prcc Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

B2RYA6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Prcc

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KKKGEQPTGQQRRKHQITYLIHQAKERELELKNTWSENKLSRRQTQAKYG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001101170

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

NIPBL Protein Vector (Mouse) (pPB-N-His)
PV205547 500 ng

NIPBL Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Human STK19 (N-GST tag)
Z500369 10 µg

Recombinant Human STK19 (N-GST tag)

Sign In for Pricing
View Details
Apolipoprotein A-I, Control Peptide (Apolipoprotein AI, Apo AI, Apo A-I, ApoA-I, Apo-AI, Apolipoprotein A1, APOA1, MGC117399)
149188 50 µg

Apolipoprotein A-I, Control Peptide (Apolipoprotein AI, Apo AI, Apo A-I, ApoA-I, Apo-AI, Apolipoprotein A1, APOA1, MGC117399)

Sign In for Pricing
View Details
Rho J Double Nickase Plasmid (h2)
sc-416839-NIC-2 20 µg

Rho J Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Human Poly ADP ribose polymerase (PARP) ELISA Kit
KTE61302-01 48 Tests

Human Poly ADP ribose polymerase (PARP) ELISA Kit

Sign In for Pricing
View Details
Human Poly ADP ribose polymerase (PARP) ELISA Kit
KTE61302-02 96 Tests

Human Poly ADP ribose polymerase (PARP) ELISA Kit

Sign In for Pricing
View Details