Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rab5c Rabbit Polyclonal Antibody (FITC)

Rab5c Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Rabl, AI326010

UniProt

Q8C266

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_077776

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nucleophosmin (Acute Myeloid Leukemia Marker) (rNPM1/1901), CF647 conjugate, 0.1mg/mL
BNC473807-500 1x 500 µL

Nucleophosmin (Acute Myeloid Leukemia Marker) (rNPM1/1901), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human SOD2/Mn-SOD Protein
PKSH030795 100 µg

Recombinant Human SOD2/Mn-SOD Protein

Sign In for Pricing
View Details
Human LOX-1 (Lectin Like Oxidized Low Density Lipoprotein Receptor 1) ELISA Kit
E-EL-H1635-01 24 Tests

Human LOX-1 (Lectin Like Oxidized Low Density Lipoprotein Receptor 1) ELISA Kit

Sign In for Pricing
View Details
Human LOX-1 (Lectin Like Oxidized Low Density Lipoprotein Receptor 1) ELISA Kit
E-EL-H1635-02 48 Tests

Human LOX-1 (Lectin Like Oxidized Low Density Lipoprotein Receptor 1) ELISA Kit

Sign In for Pricing
View Details
Human LOX-1 (Lectin Like Oxidized Low Density Lipoprotein Receptor 1) ELISA Kit
E-EL-H1635-03 96 Tests

Human LOX-1 (Lectin Like Oxidized Low Density Lipoprotein Receptor 1) ELISA Kit

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.3 + C31.7 + C31.10), CF405L conjugate, 0.1mg/mL
BNC061099-100 1x 100 µL

CD31 / PECAM-1 (C31.3 + C31.7 + C31.10), CF405L conjugate, 0.1mg/mL

Sign In for Pricing
View Details