Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rab5c Rabbit Polyclonal Antibody (HRP)

Rab5c Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Rabl, AI326010

UniProt

Q8C266

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_077776

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ghrelin Human
rAP-2578 1 Each

Ghrelin Human

Sign In for Pricing
View Details
Anti-Quiescin Q6/QSOX1 Antibody Picoband®, APC Conjugate
A04549-1-APC 100 µg/Vial

Anti-Quiescin Q6/QSOX1 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
Lentiviral human SLC43A1 shRNA (UAS) - Lentiviral human SLC43A1 shRNA (UAS, iRFP) (100)
GTR15096579 1 Vial

Lentiviral human SLC43A1 shRNA (UAS) - Lentiviral human SLC43A1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Rabbit Monoclonal TRAF-2 Antibody (8L4E1)
NBP3-15682-100ul 100 µL

Rabbit Monoclonal TRAF-2 Antibody (8L4E1)

Sign In for Pricing
View Details
Vasopressin Rabbit pAb
E47R1930 100 µL

Vasopressin Rabbit pAb

Sign In for Pricing
View Details
Collagen XVII/BP180 Rabbit Polyclonal Antibody (HRP)
orb478054 100 µL

Collagen XVII/BP180 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details