Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rab5c Rabbit Polyclonal Antibody (HRP)

Rab5c Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Rabl, AI326010

UniProt

Q8C266

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_077776

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Svs6 Double Nickase Plasmid (m2)
sc-423228-NIC-2 20 µg

Svs6 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Col8a1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6350806 1.0 µg DNA

Col8a1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Cntf sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7540207 1.0 µg DNA

Cntf sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
MK siRNA (h)
sc-39711 10 µM

MK siRNA (h)

Sign In for Pricing
View Details
Chicken 3',5'-Bisphosphate Nucleotidase 1 (BPNT1) ELISA Kit
MBS9938033 Inquire

Chicken 3',5'-Bisphosphate Nucleotidase 1 (BPNT1) ELISA Kit

Sign In for Pricing
View Details
Anti-Bcl-x antibody
STJ91842 200 µl

Anti-Bcl-x antibody

Sign In for Pricing
View Details