Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPHLN1 Rabbit Polyclonal Antibody (HRP)

PPHLN1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CR, HSPC206, HSPC232

UniProt

Q8NEY8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PPHLN1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAYRRDEMWSEGRYEYERIPRERAPPRSHPSDGYNRLVNIVPKKPPLLDR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_958923

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAP1L1 Human Over-expression Lysate
orb1346063 100 µg

NAP1L1 Human Over-expression Lysate

Sign In for Pricing
View Details
MRTF-A Polyclonal Antibody
E20-72895 100 µg

MRTF-A Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Scaf1 shRNA (UAS) - Lentiviral mouse Scaf1 shRNA (UAS, RFP) (25)
GTR15278291 1 Vial

Lentiviral mouse Scaf1 shRNA (UAS) - Lentiviral mouse Scaf1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
SPOPL (NM_001001664) Human Tagged ORF Clone Lentiviral Particle
RC209894L2V 200 µL

SPOPL (NM_001001664) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
IMPDH2 Rabbit Polyclonal Antibody (FITC)
orb102830 100 µL

IMPDH2 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Gm15293 Recombinant Protein (Mouse)
RP137570 100 µg

Gm15293 Recombinant Protein (Mouse)

Sign In for Pricing
View Details