Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rnf216 Rabbit Polyclonal Antibody (FITC)

Rnf216 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

UIP, UIP83, C86502, TRIAD3, Ubce7i, AI647468, AU019462, Ubce7ip1, 2810055G22Rik, F830018F18Rik

UniProt

P58283

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of MOUSE Rnf216

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IVNPRLEQKVIILGENGLLFPESEPLEVQNQSSEDSETELLSNPGEPAAS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

93kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHRM3 Polyclonal Antibody
E-AB-66308-01 60 µL

CHRM3 Polyclonal Antibody

Sign In for Pricing
View Details
CHRM3 Polyclonal Antibody
E-AB-66308-02 120 µL

CHRM3 Polyclonal Antibody

Sign In for Pricing
View Details
CHRM3 Polyclonal Antibody
E-AB-66308-03 200 µL

CHRM3 Polyclonal Antibody

Sign In for Pricing
View Details
Clathrin, Heavy Chain (CHC/1432), CF594 conjugate, 0.1mg/mL
BNC941432-500 1x 500 µL

Clathrin, Heavy Chain (CHC/1432), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD40 / TNFRSF5 / CD40L-Receptor (T8P2G4*A6), CF640R conjugate, 0.1mg/mL
BNC401802-500 1x 500 µL

CD40 / TNFRSF5 / CD40L-Receptor (T8P2G4*A6), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (rVEGI/1283), 0.2mg/mL
BNUB2059-500 1x 500 µL

TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (rVEGI/1283), 0.2mg/mL

Sign In for Pricing
View Details