Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMD12 Rabbit Polyclonal Antibody (HRP)

PSMD12 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P55, Rpn5, STISS

UniProt

Q5RBI3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PSMD12

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KYKDLLKLFTTMELMRWSTLVEDYGMELRKGSLESPATDVFGSTEEGEKR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002807

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZBP1 Protein Vector (Mouse) (pPB-C-His)
PV248214 500 ng

ZBP1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Lentiviral mouse Gm10471 shRNA (UAS) - Lentiviral mouse Gm10471 shRNA (UAS, GFP) plasmid
GTR15197194 1 Vial

Lentiviral mouse Gm10471 shRNA (UAS) - Lentiviral mouse Gm10471 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
PRMT5 Rabbit Polyclonal Antibody (FITC)
orb7374 100 µL

PRMT5 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Human BARD1 Pre-designed siRNA Set A
SI001435A 1 Each

Human BARD1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
FAM19A4 Protein Vector (Human) (pPM-C-HA)
PV015319 500 ng

FAM19A4 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
MYCN Polyclonal Antibody
MBS2540016-01 0.06 mL

MYCN Polyclonal Antibody

Sign In for Pricing
View Details