Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPDYE3 Rabbit Polyclonal Antibody (FITC)

SPDYE3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SPDYB2

UniProt

A6NKU9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SPDYE3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AETLCGLKMKAKRRRVSLVLPEYYEAFNRLLEDPVIKRFLAWDKDLRVSD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdk12 (NM_001109626) Mouse Tagged ORF Clone Lentiviral Particle
MR218603L3V 200 µL

Cdk12 (NM_001109626) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
STARD7 Rabbit Polyclonal Antibody
orb586426 100 µL

STARD7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ADCY2, ID (ADCY2, KIAA1060, Adenylate cyclase type 2, ATP pyrophosphate-lyase 2, Adenylate cyclase type II, Adenylyl cyclase 2) (HRP) discontinued
031627-HRP 200 µL

ADCY2, ID (ADCY2, KIAA1060, Adenylate cyclase type 2, ATP pyrophosphate-lyase 2, Adenylate cyclase type II, Adenylyl cyclase 2) (HRP) discontinued

Sign In for Pricing
View Details
Recombinant Anti-Kappa light chain Rabbit mAb
CMA5614-01 30 µL

Recombinant Anti-Kappa light chain Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-Kappa light chain Rabbit mAb
CMA5614-02 50 μL

Recombinant Anti-Kappa light chain Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-Kappa light chain Rabbit mAb
CMA5614-03 100 µL

Recombinant Anti-Kappa light chain Rabbit mAb

Sign In for Pricing
View Details