Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPDYE3 Rabbit Polyclonal Antibody (FITC)

SPDYE3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SPDYB2

UniProt

A6NKU9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SPDYE3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AETLCGLKMKAKRRRVSLVLPEYYEAFNRLLEDPVIKRFLAWDKDLRVSD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal SOX4 Antibody
NBP3-33358-100ul 100 µL

Rabbit Monoclonal SOX4 Antibody

Sign In for Pricing
View Details
Colloidal Gold Labeled Fetuin, 1mL 5nm
GP-05-5 1 mL

Colloidal Gold Labeled Fetuin, 1mL 5nm

Sign In for Pricing
View Details
Lentiviral mouse Calca shRNA (UAS) - Lentiviral mouse Calca shRNA (UAS, iRFP) plasmid
GTR15204172 1 Vial

Lentiviral mouse Calca shRNA (UAS) - Lentiviral mouse Calca shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
HES6, NT (HES6, BHLHB41, Transcription cofactor HES-6, C-HAIRY1, Class B basic helix-loop-helix protein 41, Hairy and enhancer of split 6) (MaxLight 750) discontinued
036520-ML750 100 µL

HES6, NT (HES6, BHLHB41, Transcription cofactor HES-6, C-HAIRY1, Class B basic helix-loop-helix protein 41, Hairy and enhancer of split 6) (MaxLight 750) discontinued

Sign In for Pricing
View Details
PCYT1A (NM_005017) Human Recombinant Protein
TP308130M 100 µg

PCYT1A (NM_005017) Human Recombinant Protein

Sign In for Pricing
View Details
Human LHB Ready-To-Use IHC Kit
orb3001702 50 Tests

Human LHB Ready-To-Use IHC Kit

Sign In for Pricing
View Details