Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MID2 Rabbit Polyclonal Antibody (HRP)

MID2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FXY2, RNF60, TRIM1, MRX101

UniProt

Q9UJV3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MID2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WGLWPEIRKCKEAVSCSRLAGAPRGLYNSVDSWMIVPNIKQNHYTVHGLQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ST3GAL2 Antibody Picoband® PE Conjugated
A10700-1-PE 100 µg/Vial

Anti-ST3GAL2 Antibody Picoband® PE Conjugated

Sign In for Pricing
View Details
Mouse Phosphoglycerate Mutase 2 PGAM2 ELISA Kit
BG-MUS11901 1 Each

Mouse Phosphoglycerate Mutase 2 PGAM2 ELISA Kit

Sign In for Pricing
View Details
LHX1 (LIM Homeobox 1, LIM-1, LIM1, MGC126723, MGC138141) (Biotin)
248152-Biotin 100 µL

LHX1 (LIM Homeobox 1, LIM-1, LIM1, MGC126723, MGC138141) (Biotin)

Sign In for Pricing
View Details
18 in 1 Antibiotics Cassette Test
ZKC0126 50 Tests

18 in 1 Antibiotics Cassette Test

Sign In for Pricing
View Details
TTI1 Antibody
orb45930-01 50 µg

TTI1 Antibody

Sign In for Pricing
View Details
TTI1 Antibody
orb45930-02 100 µg

TTI1 Antibody

Sign In for Pricing
View Details