Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Elf2 Rabbit Polyclonal Antibody (HRP)

Elf2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q5XIS3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Elf2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TCPRYIKWTQREKGIFKLVDSKAVSKLWGKHKNKPDMNYETMGRALRYYY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001012181

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

HCV 1/2/3 Genotype Real-TM Real Time PCR kit for detection of genotypes 1, 2, 3
R1-Gen-4X 50 Tests

HCV 1/2/3 Genotype Real-TM Real Time PCR kit for detection of genotypes 1, 2, 3

Sign In for Pricing
View Details
Cat Tartrate Resistant Acid Phosphatase ELISA Kit
MBS101710 Inquire

Cat Tartrate Resistant Acid Phosphatase ELISA Kit

Sign In for Pricing
View Details
Tissue, Total Protein, Human Adult Normal, Colon descending
MBS657299-01 1 mg

Tissue, Total Protein, Human Adult Normal, Colon descending

Sign In for Pricing
View Details
Tissue, Total Protein, Human Adult Normal, Colon descending
MBS657299-02 5x 1 mg

Tissue, Total Protein, Human Adult Normal, Colon descending

Sign In for Pricing
View Details
GC1q R Recombinant Antibody, Cy3 Conjugated
bsm-61312R-Cy3-01 20 µL

GC1q R Recombinant Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
GC1q R Recombinant Antibody, Cy3 Conjugated
bsm-61312R-Cy3-02 100 µL

GC1q R Recombinant Antibody, Cy3 Conjugated

Sign In for Pricing
View Details