Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mprip Rabbit Polyclonal Antibody (FITC)

Mprip Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Mrip, M-rip, Rhoip3, p116Rip

UniProt

Q9ERE6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Mprip

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ATISAIEAMKNAHREEMERELEKSQRSQISSINSDIEALRRQYLEELQSV

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

113kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_446266

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse BMP Binding Endothelial Regulator (BMPER) ELISA Kit-Sandwich
EK6F198-01 48 Test

Mouse BMP Binding Endothelial Regulator (BMPER) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Mouse BMP Binding Endothelial Regulator (BMPER) ELISA Kit-Sandwich
EK6F198-02 96 Tests

Mouse BMP Binding Endothelial Regulator (BMPER) ELISA Kit-Sandwich

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to TTK Protein Kinase (TTK)
MBS2079019-01 0.1 mL

FITC-Linked Polyclonal Antibody to TTK Protein Kinase (TTK)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to TTK Protein Kinase (TTK)
MBS2079019-02 0.2 mL

FITC-Linked Polyclonal Antibody to TTK Protein Kinase (TTK)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to TTK Protein Kinase (TTK)
MBS2079019-03 0.5 mL

FITC-Linked Polyclonal Antibody to TTK Protein Kinase (TTK)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to TTK Protein Kinase (TTK)
MBS2079019-04 1 mL

FITC-Linked Polyclonal Antibody to TTK Protein Kinase (TTK)

Sign In for Pricing
View Details