Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXC8 Rabbit Polyclonal Antibody (Biotin)

HOXC8 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HOX3, HOX3A

UniProt

P31273

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HOXC8

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SVVQYPDCKSSANTNSSEGQGHLNQNSSPSLMFPWMRPHAPGRRSGRQTY

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_073149

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fern prothallium, section with archegonia *
Pt156e 7.6 x 2.6 cm

Fern prothallium, section with archegonia *

Sign In for Pricing
View Details
Anti Human EGF Pab
165555 100 µg

Anti Human EGF Pab

Sign In for Pricing
View Details
MAN2C1, NT (MAN2C1, MANA, MANA1, Alpha-mannosidase 2C1, Alpha mannosidase 6A8B, Alpha-D-mannoside mannohydrolase, Mannosidase alpha class 2C member 1) (MaxLight 650)
MBS6318184-01 0.1 mL

MAN2C1, NT (MAN2C1, MANA, MANA1, Alpha-mannosidase 2C1, Alpha mannosidase 6A8B, Alpha-D-mannoside mannohydrolase, Mannosidase alpha class 2C member 1) (MaxLight 650)

Sign In for Pricing
View Details
MAN2C1, NT (MAN2C1, MANA, MANA1, Alpha-mannosidase 2C1, Alpha mannosidase 6A8B, Alpha-D-mannoside mannohydrolase, Mannosidase alpha class 2C member 1) (MaxLight 650)
MBS6318184-02 5x 0.1 mL

MAN2C1, NT (MAN2C1, MANA, MANA1, Alpha-mannosidase 2C1, Alpha mannosidase 6A8B, Alpha-D-mannoside mannohydrolase, Mannosidase alpha class 2C member 1) (MaxLight 650)

Sign In for Pricing
View Details
Chlamydia sp. LPS (HRP)
C4250-42-HRP 100 µL

Chlamydia sp. LPS (HRP)

Sign In for Pricing
View Details
Lymphotactin (Small Inducible Cytokine Subfamily C Member 1, SCYC1, Chemokine C Motif Ligand 1, Ltn) (PE)
MBS6485659-01 0.1 mL

Lymphotactin (Small Inducible Cytokine Subfamily C Member 1, SCYC1, Chemokine C Motif Ligand 1, Ltn) (PE)

Sign In for Pricing
View Details