Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pou3f3 Rabbit Polyclonal Antibody (HRP)

Pou3f3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Brn1, RHS1

UniProt

Q63262

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Pou3f3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VVRVWFCNRRQKEKRMTPPGIQQQTPDDVYSQVGTVSADTPPPHHGLQTS

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Porcine, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_620192

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Substance P Blocking Peptide
MBS9625913-01 1 mg

Substance P Blocking Peptide

Sign In for Pricing
View Details
Substance P Blocking Peptide
MBS9625913-02 5x 1 mg

Substance P Blocking Peptide

Sign In for Pricing
View Details
Human BAHCC1 Knockout A549 cell line
GTR15407703 1 Vial

Human BAHCC1 Knockout A549 cell line

Sign In for Pricing
View Details
GTF2IRD1, NT (GTF2IRD1, CREAM1, GTF3, MUSTRD1, RBAP2, WBSCR11, WBSCR12, General transcription factor II-I repeat domain-containing protein 1, General transcription factor III, MusTRD1/BEN, Muscle TFII-I repeat domain-containing protein 1, Slow-muscle-fibe
MBS6304920-01 0.2 mL

GTF2IRD1, NT (GTF2IRD1, CREAM1, GTF3, MUSTRD1, RBAP2, WBSCR11, WBSCR12, General transcription factor II-I repeat domain-containing protein 1, General transcription factor III, MusTRD1/BEN, Muscle TFII-I repeat domain-containing protein 1, Slow-muscle-fibe

Sign In for Pricing
View Details
GTF2IRD1, NT (GTF2IRD1, CREAM1, GTF3, MUSTRD1, RBAP2, WBSCR11, WBSCR12, General transcription factor II-I repeat domain-containing protein 1, General transcription factor III, MusTRD1/BEN, Muscle TFII-I repeat domain-containing protein 1, Slow-muscle-fibe
MBS6304920-02 5x 0.2 mL

GTF2IRD1, NT (GTF2IRD1, CREAM1, GTF3, MUSTRD1, RBAP2, WBSCR11, WBSCR12, General transcription factor II-I repeat domain-containing protein 1, General transcription factor III, MusTRD1/BEN, Muscle TFII-I repeat domain-containing protein 1, Slow-muscle-fibe

Sign In for Pricing
View Details
ClcA Antibody
orb811675 2 mg

ClcA Antibody

Sign In for Pricing
View Details