Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prdm12 Rabbit Polyclonal Antibody (HRP)

Prdm12 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Gm998

UniProt

A2AJ77

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MTYIKCARNEQEQNLEVVQIGTSIFYKAIEMIPPDQELLVWYGNSHNTFL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001116834

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Kappa Light Chain (KLC264), CF640R conjugate, 0.1mg/mL
BNC400264-100 1x 100 µL

Human Kappa Light Chain (KLC264), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PTPRB (NM_001109754) Human Recombinant Protein
TP326479 20 µg

PTPRB (NM_001109754) Human Recombinant Protein

Sign In for Pricing
View Details
HIF-1 alpha (HIF1A) Rabbit Polyclonal Antibody
TA367219 100 µL

HIF-1 alpha (HIF1A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Snrnp35 Mouse Gene Knockout Kit (CRISPR)
KN516396 1 Kit

Snrnp35 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Repulsive Guidance Molecule C (HFE2) Mouse Monoclonal Antibody [Clone ID: OTI8F4]
CF809341 100 µg

Repulsive Guidance Molecule C (HFE2) Mouse Monoclonal Antibody [Clone ID: OTI8F4]

Sign In for Pricing
View Details
Emamectin B1 Benzoate (Mixture of B1a and B1b)
TRC-E520503-250MG 250 mg

Emamectin B1 Benzoate (Mixture of B1a and B1b)

Sign In for Pricing
View Details