Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prdm12 Rabbit Polyclonal Antibody (HRP)

Prdm12 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Gm998

UniProt

A2AJ77

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MTYIKCARNEQEQNLEVVQIGTSIFYKAIEMIPPDQELLVWYGNSHNTFL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001116834

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Fibroblast Growth Factor 2, Basic (FGF2) ELISA Kit
RDR-FGF2-b-01 96 Tests

Bovine Fibroblast Growth Factor 2, Basic (FGF2) ELISA Kit

Sign In for Pricing
View Details
Bovine Fibroblast Growth Factor 2, Basic (FGF2) ELISA Kit
RDR-FGF2-b-02 48 Tests

Bovine Fibroblast Growth Factor 2, Basic (FGF2) ELISA Kit

Sign In for Pricing
View Details
RAC1 Rabbit Polyclonal Antibody
AP02713PU-S 50 µL

RAC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Chk2 (CHEK2) pThr68 Rabbit Polyclonal Antibody
AP01556PU-N 100 µg

Chk2 (CHEK2) pThr68 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Uncoated Human OPG (Osteoprotegerin) ELISA Kit
E-UNEL-H0130-01 5x 96 Tests

Uncoated Human OPG (Osteoprotegerin) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human OPG (Osteoprotegerin) ELISA Kit
E-UNEL-H0130-02 15x 96 Tests

Uncoated Human OPG (Osteoprotegerin) ELISA Kit

Sign In for Pricing
View Details