Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS15 Rabbit Polyclonal Antibody (Biotin)

MRPS15 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DC37, S15mt, RPMS15, MPR-S15

UniProt

P82914

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MRPS15

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QFMKKIVANPEDTRSLEARIIALSVKIRSYEEHLEKHRKDKAHKRYLLMS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_112570

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIB1 (Tribbles Homolog 1 (Drosophila), C8FW, GIG2, SKIP1) (HRP)
MBS6182643-01 0.1 mL

TRIB1 (Tribbles Homolog 1 (Drosophila), C8FW, GIG2, SKIP1) (HRP)

Sign In for Pricing
View Details
TRIB1 (Tribbles Homolog 1 (Drosophila), C8FW, GIG2, SKIP1) (HRP)
MBS6182643-02 5x 0.1 mL

TRIB1 (Tribbles Homolog 1 (Drosophila), C8FW, GIG2, SKIP1) (HRP)

Sign In for Pricing
View Details
Recombinant Human IL-1α
P5102-1mg 1 mg

Recombinant Human IL-1α

Sign In for Pricing
View Details
POLR1B, NT (POLR1B, DNA-directed RNA polymerase I subunit RPA2, DNA-directed RNA polymerase I 135kD polypeptide) (PE) discontinued
040251-PE 200 µL

POLR1B, NT (POLR1B, DNA-directed RNA polymerase I subunit RPA2, DNA-directed RNA polymerase I 135kD polypeptide) (PE) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal ADAM10 Antibody (11G2) [HRP]
NBP3-21496H 0.1 mL

Mouse Monoclonal ADAM10 Antibody (11G2) [HRP]

Sign In for Pricing
View Details
Recombinant Salmonella Typhi OMP Antigen, His-tagged
OMP-420 1 Vial

Recombinant Salmonella Typhi OMP Antigen, His-tagged

Sign In for Pricing
View Details