Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS15 Rabbit Polyclonal Antibody (HRP)

MRPS15 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DC37, S15mt, RPMS15, MPR-S15

UniProt

P82914

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MRPS15

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QFMKKIVANPEDTRSLEARIIALSVKIRSYEEHLEKHRKDKAHKRYLLMS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_112570

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-HDHD2 Antibody Picoband®
A15632-1 100 µg/Vial

Anti-HDHD2 Antibody Picoband®

Sign In for Pricing
View Details
Interleukin 17 (IL-17, CTLA8, IL-17A, Interleukin-17A precursor, Cytotoxic T-lymphocyte-associated antigen 8)
I8439-07 100 µg

Interleukin 17 (IL-17, CTLA8, IL-17A, Interleukin-17A precursor, Cytotoxic T-lymphocyte-associated antigen 8)

Sign In for Pricing
View Details
HIPK4 (HIPK4, Homeodomain-interacting protein kinase 4) (MaxLight 650) discontinued
036570-ML650 100 µL

HIPK4 (HIPK4, Homeodomain-interacting protein kinase 4) (MaxLight 650) discontinued

Sign In for Pricing
View Details
JAK1 Protein (N-GST, Human)
P526111 100 µg

JAK1 Protein (N-GST, Human)

Sign In for Pricing
View Details
EFCAB3 siRNA (Mouse)
orb1840937-01 15 nmol

EFCAB3 siRNA (Mouse)

Sign In for Pricing
View Details
EFCAB3 siRNA (Mouse)
orb1840937-02 30 nmol

EFCAB3 siRNA (Mouse)

Sign In for Pricing
View Details