Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOX15 Rabbit Polyclonal Antibody (Biotin)

SOX15 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SOX20, SOX26, SOX27

UniProt

O60248

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SOX15

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ALPGSSQDQAWSLEPPAATAAASSSSGPQEREGAGSPAAPGTLPLEKVKR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_008873

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLTK antibody
70R-32167 0.1 mg

MLTK antibody

Sign In for Pricing
View Details
CD8A Mouse Monoclonal Antibody [Clone ID: fCD8]
AM08112FC-N 500 µg

CD8A Mouse Monoclonal Antibody [Clone ID: fCD8]

Sign In for Pricing
View Details
Funnel Attachment for SHA20702
SHA2082 1 Each

Funnel Attachment for SHA20702

Sign In for Pricing
View Details
ACOT4 (PTE2B, PTEIB, Acyl-coenzyme A thioesterase 4, Acyl-CoA thioesterase 4, PTE-2b, Peroxisomal acyl coenzyme A thioester hydrolase Ib, Peroxisomal long-chain acyl-CoA thioesterase Ib, PTE-Ib) discontinued
341689-01 100 µL

ACOT4 (PTE2B, PTEIB, Acyl-coenzyme A thioesterase 4, Acyl-CoA thioesterase 4, PTE-2b, Peroxisomal acyl coenzyme A thioester hydrolase Ib, Peroxisomal long-chain acyl-CoA thioesterase Ib, PTE-Ib) discontinued

Sign In for Pricing
View Details
ACOT4 (PTE2B, PTEIB, Acyl-coenzyme A thioesterase 4, Acyl-CoA thioesterase 4, PTE-2b, Peroxisomal acyl coenzyme A thioester hydrolase Ib, Peroxisomal long-chain acyl-CoA thioesterase Ib, PTE-Ib) discontinued
341689-02 200 µL

ACOT4 (PTE2B, PTEIB, Acyl-coenzyme A thioesterase 4, Acyl-CoA thioesterase 4, PTE-2b, Peroxisomal acyl coenzyme A thioester hydrolase Ib, Peroxisomal long-chain acyl-CoA thioesterase Ib, PTE-Ib) discontinued

Sign In for Pricing
View Details
FXR1 siRNA (Rat)
MBS8215717-01 15 nmol

FXR1 siRNA (Rat)

Sign In for Pricing
View Details