Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp36l1 Rabbit Polyclonal Antibody (FITC)

Zfp36l1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Brf, Brf1, ERF1, TIS1, cMG1, Berg36, TIS11b, AW742437, AW743212, D530020L18Rik

UniProt

P23950

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PMSESPHMFDSPPSPQDSLSDHEGYLSSSSSSHSGSDSPTLDNSRRLPIF

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_031590

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM181A 3'UTR Lenti-reporter-Luc Vector
19858081 1.0 µg

FAM181A 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Limd2 CRISPR Activation Plasmid (h)
sc-413399-ACT 20 µg

Limd2 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Anti-Human TSHR/LGR3 Antibody (M22)
FHD18150 100 μg

Anti-Human TSHR/LGR3 Antibody (M22)

Sign In for Pricing
View Details
Mouse Monoclonal SHANK2 Antibody (N23b/49) [CoraFluor 1]
NBP2-12913CL1 0.1 mL

Mouse Monoclonal SHANK2 Antibody (N23b/49) [CoraFluor 1]

Sign In for Pricing
View Details
GGA1 (ADP-ribosylation Factor-binding Protein GGA1, Gamma-adaptin-related Protein 1, Golgi-localized, gamma Ear-containing, ARF-binding Protein 1) (MaxLight 750) discontinued
127284-ML750 100 µL

GGA1 (ADP-ribosylation Factor-binding Protein GGA1, Gamma-adaptin-related Protein 1, Golgi-localized, gamma Ear-containing, ARF-binding Protein 1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Lentiviral human FAM126A shRNA (UAS) - Lentiviral human FAM126A shRNA (UAS, GFP) (25)
GTR15343931 1 Vial

Lentiviral human FAM126A shRNA (UAS) - Lentiviral human FAM126A shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details