Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNF1A Rabbit Polyclonal Antibody (FITC)

HNF1A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HNF1, LFB1, TCF1, HNF4A, MODY3, TCF-1, HNF-1A, IDDM20, HNF1alpha

UniProt

P20823

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HNF1A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000536

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS6 Rabbit Polyclonal Antibody
AP53742PU-N 400 µL

RPS6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
G protein alpha 16 (GNA15) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6B3]
TA808136AM 100 µL

G protein alpha 16 (GNA15) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6B3]

Sign In for Pricing
View Details
Tagln3 Mouse Gene Knockout Kit (CRISPR)
KN517162 1 Kit

Tagln3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Fetal Hemoglobin Antibody
RC-15552-01 50 μL

Recombinant Fetal Hemoglobin Antibody

Sign In for Pricing
View Details
Recombinant Fetal Hemoglobin Antibody
RC-15552-02 100 µL

Recombinant Fetal Hemoglobin Antibody

Sign In for Pricing
View Details
Recombinant Fetal Hemoglobin Antibody
RC-15552-03 1 mL

Recombinant Fetal Hemoglobin Antibody

Sign In for Pricing
View Details