Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNF1A Rabbit Polyclonal Antibody (HRP)

HNF1A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HNF1, LFB1, TCF1, HNF4A, MODY3, TCF-1, HNF-1A, IDDM20, HNF1alpha

UniProt

P20823

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HNF1A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000536

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTM1 Human Gene Knockout Kit (CRISPR)
KN205306LP 1 Kit

MTM1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF740 conjugate, 0.1mg/mL
BNC741037-100 1x 100 µL

CD44 Standard (DF1485), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
26-Deoxymonensin A Sodium Salt
TRC-D243000-10MG 10 mg

26-Deoxymonensin A Sodium Salt

Sign In for Pricing
View Details
VC Lambda / Hind III Marker (ready-to-use), 5 x 50µg
NM2408 5 x 50μg

VC Lambda / Hind III Marker (ready-to-use), 5 x 50µg

Sign In for Pricing
View Details
LOC401052 Human Gene Knockout Kit (CRISPR)
KN415358 1 Kit

LOC401052 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
OVGP1 (NM_002557) Human Over-expression Lysate
LC419261 20 µg

OVGP1 (NM_002557) Human Over-expression Lysate

Sign In for Pricing
View Details