Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF157 Rabbit Polyclonal Antibody (FITC)

ZNF157 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HZF22

UniProt

P51786

Immunogen

The immunogen for Anti-ZNF157 antibody is: synthetic peptide directed towards the N-terminal region of Human ZN157

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TYSNLASVGLCVAKPEMIFKLERGEELWILEEESSGHGYSGSLSLLCGNG

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF4A3 Rabbit Polyclonal Antibody (BF680)
orb1594333 100 µL

EIF4A3 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Mouse Anti-Human B7-H5, PE Conjugated mAb
CM085-01 25 Tests

Mouse Anti-Human B7-H5, PE Conjugated mAb

Sign In for Pricing
View Details
Mouse Anti-Human B7-H5, PE Conjugated mAb
CM085-02 100 Tests

Mouse Anti-Human B7-H5, PE Conjugated mAb

Sign In for Pricing
View Details
FAM183A Human shRNA Lentiviral Particle (Locus ID 440585)
TL321097V 500 µL Each

FAM183A Human shRNA Lentiviral Particle (Locus ID 440585)

Sign In for Pricing
View Details
D8S2298E Lentiviral Activation Particles (m2)
sc-430831-LAC-2 200 µL

D8S2298E Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Rabbit Polyclonal FcgR4/CD16-2 Antibody [DyLight 594]
NBP3-05900DL594 0.1 mL

Rabbit Polyclonal FcgR4/CD16-2 Antibody [DyLight 594]

Sign In for Pricing
View Details