Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF157 Rabbit Polyclonal Antibody (HRP)

ZNF157 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HZF22

UniProt

P51786

Immunogen

The immunogen for Anti-ZNF157 antibody is: synthetic peptide directed towards the N-terminal region of Human ZN157

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TYSNLASVGLCVAKPEMIFKLERGEELWILEEESSGHGYSGSLSLLCGNG

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARHGAP20 AAV Vector (Human) (CMV)
12286101 1 µg

ARHGAP20 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
LGALS9 CRISPRa sgRNA lentivector (set of three targets)(Human)
26475121 3x 1.0µg DNA

LGALS9 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
DDX19B Antibody - N-terminal region : Biotin (ARP40300_T100-Biotin)
ARP40300_T100-Biotin 100 µL

DDX19B Antibody - N-terminal region : Biotin (ARP40300_T100-Biotin)

Sign In for Pricing
View Details
AP2A1 Antibody - C-terminal region : Biotin (ARP59972_P050-Biotin)
ARP59972_P050-Biotin 100 µL

AP2A1 Antibody - C-terminal region : Biotin (ARP59972_P050-Biotin)

Sign In for Pricing
View Details
IFluor® 700 Anti-human CD140a Antibody *16A1*
114000J0-AAT 100 Tests

IFluor® 700 Anti-human CD140a Antibody *16A1*

Sign In for Pricing
View Details
NRP1 Adenovirus (Human)
32179051 1.0 mL

NRP1 Adenovirus (Human)

Sign In for Pricing
View Details