Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ONECUT2 Rabbit Polyclonal Antibody (HRP)

ONECUT2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OC2, OC-2

UniProt

O95948

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ONECUT2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LQEPEFQRMSALRLAACKRKEQEPNKDRNNSQKKSRLVFTDLQRRTLFAI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004843

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Pak7 shRNA (UAS) - Lentiviral mouse Pak7 shRNA (UAS, RFP) (25)
GTR15258359 1 Vial

Lentiviral mouse Pak7 shRNA (UAS) - Lentiviral mouse Pak7 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Lentiviral mouse Epgn shRNA (UAS) - Lentiviral mouse Epgn shRNA (UAS, iRFP) (25)
GTR15292922 1 Vial

Lentiviral mouse Epgn shRNA (UAS) - Lentiviral mouse Epgn shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Neuromedin-B Receptor (NMBR) Mouse ELISA Kit
F3406 96 Tests

Neuromedin-B Receptor (NMBR) Mouse ELISA Kit

Sign In for Pricing
View Details
Kappa Light Chain Recombinant Mouse monoclonal Antibody
HA610141 100 µg

Kappa Light Chain Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
Probetacellulin Polyclonal Antibody
orb311547-01 50 μL

Probetacellulin Polyclonal Antibody

Sign In for Pricing
View Details
Probetacellulin Polyclonal Antibody
orb311547-02 100 µL

Probetacellulin Polyclonal Antibody

Sign In for Pricing
View Details