Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Preb Rabbit Polyclonal Antibody (HRP)

Preb Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C85705

UniProt

Q9WUQ2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Preb

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RRRGVELYRAPFPLYALRIDPKTGLLIAAGGGGAAKTGIKNGVHFLQLEL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057912

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r95 (NM_001167538) Mouse Tagged Lenti ORF Clone
MR223490L3 10 µg

Vmn1r95 (NM_001167538) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CYP2A13 Antibody, Biotin conjugated
A77320-100UL 100 µL

CYP2A13 Antibody, Biotin conjugated

Sign In for Pricing
View Details
N-Shc shRNA (m) Lentiviral Particles
sc-40976-V 200 µL

N-Shc shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
DAPK3 Knockout 786-O Polyclonal Cells
ARG4902 1 Million

DAPK3 Knockout 786-O Polyclonal Cells

Sign In for Pricing
View Details
Hepatitis A Virus / HAV Mouse Monoclonal Antibody [Clone ID: 818]
BM3237 1 mg

Hepatitis A Virus / HAV Mouse Monoclonal Antibody [Clone ID: 818]

Sign In for Pricing
View Details
Lentiviral human ACLY shRNA (UAS) - Lentiviral human ACLY shRNA (UAS, iRFP) (25)
GTR15347933 1 Vial

Lentiviral human ACLY shRNA (UAS) - Lentiviral human ACLY shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details