Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARIH2 Rabbit Polyclonal Antibody (HRP)

ARIH2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ARI2, TRIAD1

UniProt

O95376

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ARIH2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSVDMNSQGSDSNEEDYDPNCEEEEEEEEDDPGDIEDYYVGVASDVEQQG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006312

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Hmcn1 Pre-designed siRNA Set B
SI206280B 1 Each

Rat Hmcn1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
MSR1 (Macrophage Scavenger Receptor 1) BioAssayTM ELISA Kit (Human) discontinued
383743 96 Tests

MSR1 (Macrophage Scavenger Receptor 1) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
Rabbit Guinea Pig IgG Antibody, FITC conjugated
orb357979 500 µg

Rabbit Guinea Pig IgG Antibody, FITC conjugated

Sign In for Pricing
View Details
PDCD2 (Programmed Cell Death Protein 2, Zinc Finger MYND Domain-containing Protein 7, Zinc Finger Protein Rp-8, RP8, ZMYND7, MGC12347)
131032 100 µg

PDCD2 (Programmed Cell Death Protein 2, Zinc Finger MYND Domain-containing Protein 7, Zinc Finger Protein Rp-8, RP8, ZMYND7, MGC12347)

Sign In for Pricing
View Details
HEBP1, NT (HEBP1, HBP, Heme-binding protein 1, p22HBP) (MaxLight 490)
MBS6306016-01 0.1 mL

HEBP1, NT (HEBP1, HBP, Heme-binding protein 1, p22HBP) (MaxLight 490)

Sign In for Pricing
View Details
HEBP1, NT (HEBP1, HBP, Heme-binding protein 1, p22HBP) (MaxLight 490)
MBS6306016-02 5x 0.1 mL

HEBP1, NT (HEBP1, HBP, Heme-binding protein 1, p22HBP) (MaxLight 490)

Sign In for Pricing
View Details