Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM31 Rabbit Polyclonal Antibody (HRP)

TRIM31 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RNF, HCG1, HCGI, C6orf13

UniProt

Q9BZY9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRIM31

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GSLKKFKDQLQADRKKDENRFFKSMNKNDMKSWGLLQKNNHKMNKTSEPG

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_008959

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-PKC alpha (Thr638) Recombinant Rabbit mAb
E43S43171 100 µL

Phospho-PKC alpha (Thr638) Recombinant Rabbit mAb

Sign In for Pricing
View Details
APOO sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0108206 1.0 µg DNA

APOO sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Bak Antibody (BH3 Domain Specific)
orb1937002-01 50 µL

Bak Antibody (BH3 Domain Specific)

Sign In for Pricing
View Details
Bak Antibody (BH3 Domain Specific)
orb1937002-02 100 µL

Bak Antibody (BH3 Domain Specific)

Sign In for Pricing
View Details
TipOne RPT 300 uL ultra low retention graduated pipette tips in racks, 80 racks of 96 tips (7680 tips) .Non-sterile.
1160-9840 7680 Tips

TipOne RPT 300 uL ultra low retention graduated pipette tips in racks, 80 racks of 96 tips (7680 tips) .Non-sterile.

Sign In for Pricing
View Details
Recombinant Human CD35 protein
TD-ATMP00221HU 50 µg

Recombinant Human CD35 protein

Sign In for Pricing
View Details