Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM31 Rabbit Polyclonal Antibody (HRP)

TRIM31 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RNF, HCG1, HCGI, C6orf13

UniProt

Q9BZY9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRIM31

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GSLKKFKDQLQADRKKDENRFFKSMNKNDMKSWGLLQKNNHKMNKTSEPG

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_008959

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Tropomyosin (TPM) Antibody
33498-05111 150 µg

Human Tropomyosin (TPM) Antibody

Sign In for Pricing
View Details
Grpel1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4800408 1.0 µg DNA

Grpel1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
MELK Rabbit Monoclonal Antibody [Clone ID: R06-4D6]
TA421946 100 µL

MELK Rabbit Monoclonal Antibody [Clone ID: R06-4D6]

Sign In for Pricing
View Details
Mouse Rlim qPCR Primer Pair
QM20234S 200 Tests

Mouse Rlim qPCR Primer Pair

Sign In for Pricing
View Details
Human ATXN7L3B knockout cell line
ABC-KH1245 1 Vial

Human ATXN7L3B knockout cell line

Sign In for Pricing
View Details
Frozen Tissue Sections, Small intestine
CS526690 5x 5 µm

Frozen Tissue Sections, Small intestine

Sign In for Pricing
View Details