Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLF8 Rabbit Polyclonal Antibody (HRP)

KLF8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BKLF3, ZNF741

UniProt

O95600

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KLF8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQTLVVS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_009181

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TG Chemi-Luminescent ELISA Kit (Human)
OKCD03942-96W 96 Well

TG Chemi-Luminescent ELISA Kit (Human)

Sign In for Pricing
View Details
B4GALNT4 Mouse Monoclonal Antibody [Clone ID: OTI7F2]
CF816146 100 µg

B4GALNT4 Mouse Monoclonal Antibody [Clone ID: OTI7F2]

Sign In for Pricing
View Details
Mouse Olfr54 activation kit by CRISPRa
GA203034 1 Kit

Mouse Olfr54 activation kit by CRISPRa

Sign In for Pricing
View Details
GTF2A1 (Transcription Initiation Factor IIA Subunit 1, General Transcription Factor IIA Subunit 1, TFIIAL, Transcription Initiation Factor TFIIA 42kD Subunit, TFIIA-42, TF2A1, MGC129969, MGC129970) (APC)
127625-APC 100 µL

GTF2A1 (Transcription Initiation Factor IIA Subunit 1, General Transcription Factor IIA Subunit 1, TFIIAL, Transcription Initiation Factor TFIIA 42kD Subunit, TFIIA-42, TF2A1, MGC129969, MGC129970) (APC)

Sign In for Pricing
View Details
Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to FITC,  10nm
GM-502-10 1 mL

Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to FITC, 10nm

Sign In for Pricing
View Details
Pgap2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV658448 1.0 µg DNA

Pgap2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details