Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DBP Rabbit Polyclonal Antibody (FITC)

DBP Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DABP, taxREB302

UniProt

Q10586

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human DBP

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FSEEELKPQPIMKKARKIQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001343

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ALYREF Antibody Picoband®, Dylight550 Conjugate
A03580-3-Dylight550 100 µg

Anti-ALYREF Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
Epidermal Growth Factor-Like Module-Containing Mucin-Like Receptor 3 (EGF-like Module Containing Mucin-like Hormone Receptor-like 3, EGF-like Module Containing Mucin-like Receptor 3, EMR3) (MaxLight 650)
MBS6255925-01 0.1 mL

Epidermal Growth Factor-Like Module-Containing Mucin-Like Receptor 3 (EGF-like Module Containing Mucin-like Hormone Receptor-like 3, EGF-like Module Containing Mucin-like Receptor 3, EMR3) (MaxLight 650)

Sign In for Pricing
View Details
Epidermal Growth Factor-Like Module-Containing Mucin-Like Receptor 3 (EGF-like Module Containing Mucin-like Hormone Receptor-like 3, EGF-like Module Containing Mucin-like Receptor 3, EMR3) (MaxLight 650)
MBS6255925-02 5x 0.1 mL

Epidermal Growth Factor-Like Module-Containing Mucin-Like Receptor 3 (EGF-like Module Containing Mucin-like Hormone Receptor-like 3, EGF-like Module Containing Mucin-like Receptor 3, EMR3) (MaxLight 650)

Sign In for Pricing
View Details
Γ-aminobutyric acid-OVA conjugate
CSB-MC00532a0105 1 mg

Γ-aminobutyric acid-OVA conjugate

Sign In for Pricing
View Details
SLC17A2 Antibody
orb127233-01 25 µg

SLC17A2 Antibody

Sign In for Pricing
View Details
SLC17A2 Antibody
orb127233-02 50 µg

SLC17A2 Antibody

Sign In for Pricing
View Details