Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DBP Rabbit Polyclonal Antibody (HRP)

DBP Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DABP, taxREB302

UniProt

Q10586

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human DBP

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FSEEELKPQPIMKKARKIQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001343

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PetC3 Antibody
PHY5350S 150 μg

PetC3 Antibody

Sign In for Pricing
View Details
CALML6 Antibody
orb1562077-01 50 µL

CALML6 Antibody

Sign In for Pricing
View Details
CALML6 Antibody
orb1562077-02 100 µL

CALML6 Antibody

Sign In for Pricing
View Details
CALML6 Antibody
orb1562077-03 200 µL

CALML6 Antibody

Sign In for Pricing
View Details
Vmo1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3585508 1.0 µg DNA

Vmo1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Chicken Regulation of nuclear pre mRNA domain containing protein 1A (RPRD1A) ELISA Kit
GTR10365902 96 Well

Chicken Regulation of nuclear pre mRNA domain containing protein 1A (RPRD1A) ELISA Kit

Sign In for Pricing
View Details