Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E2f5 Rabbit Polyclonal Antibody (HRP)

E2f5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

E2F-5, AU024671

UniProt

Q61502

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QPSSQSSTSVTPQKSTMAAQNLPEQHVSERSQTFQQTPAAEVSSGSISGD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_031918

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP3K5 (Ser966) (Mitogen-activated Protein Kinase Kinase Kinase 5, MAPKKK5, Apoptosis Signal-regulating Kinase 1, ASK1, ASK-1, MAPK/ERK Kinase Kinase 5, MEK Kinase 5, MEKK 5, MEKK5) (MaxLight 550) discontinued
M2867-52N-ML550 100 µL

MAP3K5 (Ser966) (Mitogen-activated Protein Kinase Kinase Kinase 5, MAPKKK5, Apoptosis Signal-regulating Kinase 1, ASK1, ASK-1, MAPK/ERK Kinase Kinase 5, MEK Kinase 5, MEKK 5, MEKK5) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Erbin Conjugated Antibody
MBS9453294-01 0.1 mL (AF350)

Erbin Conjugated Antibody

Sign In for Pricing
View Details
Erbin Conjugated Antibody
MBS9453294-02 0.1 mL (AF405)

Erbin Conjugated Antibody

Sign In for Pricing
View Details
Erbin Conjugated Antibody
MBS9453294-03 0.1 mL (AF488)

Erbin Conjugated Antibody

Sign In for Pricing
View Details
Erbin Conjugated Antibody
MBS9453294-04 0.1 mL (AF555)

Erbin Conjugated Antibody

Sign In for Pricing
View Details
Erbin Conjugated Antibody
MBS9453294-05 0.1 mL (Biotin)

Erbin Conjugated Antibody

Sign In for Pricing
View Details