Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E2f5 Rabbit Polyclonal Antibody (HRP)

E2f5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

E2F-5, AU024671

UniProt

Q61502

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QPSSQSSTSVTPQKSTMAAQNLPEQHVSERSQTFQQTPAAEVSSGSISGD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_031918

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human MAP3K14 shRNA (UAS) - Lentiviral human MAP3K14 shRNA (UAS, RFP) (100)
GTR15335775 1 Vial

Lentiviral human MAP3K14 shRNA (UAS) - Lentiviral human MAP3K14 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Anti-ULK1 Antibody Picoband®, Dylight550 Conjugate
A00584-1-Dylight550 100 µg

Anti-ULK1 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
Muffle Box Furnace (BER-3215)
BER-3215 1 Unit

Muffle Box Furnace (BER-3215)

Sign In for Pricing
View Details
OSTN Antibody, HRP conjugated
CSB-PA017269LB01HU-01 50 μL

OSTN Antibody, HRP conjugated

Sign In for Pricing
View Details
OSTN Antibody, HRP conjugated
CSB-PA017269LB01HU-02 100 µL

OSTN Antibody, HRP conjugated

Sign In for Pricing
View Details
Anti-FUBP1 Antibody (R2J63)
RHJ37102 100 μg

Anti-FUBP1 Antibody (R2J63)

Sign In for Pricing
View Details