Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERG Rabbit Polyclonal Antibody (HRP)

ERG Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P55, erg-3

UniProt

P11308

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ERG

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSYHAHPQ

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004440

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human RBMXL3 sgRNA gene knockout kit - Lentiviral human RBMXL3 sgRNA gene knockout kit (25)
GTR15363222 1 Vial

Lentiviral human RBMXL3 sgRNA gene knockout kit - Lentiviral human RBMXL3 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Lentiviral human RAB8B shRNA (UAS) - Lentiviral human RAB8B shRNA (UAS) plasmid
GTR15325186 1 Vial

Lentiviral human RAB8B shRNA (UAS) - Lentiviral human RAB8B shRNA (UAS) plasmid

Sign In for Pricing
View Details
AdmiRa-mmu-miR-148b-3p-Off Virus
mm5143 1.0 mL

AdmiRa-mmu-miR-148b-3p-Off Virus

Sign In for Pricing
View Details
MCC Rabbit Polyclonal Antibody (Fluoro594)
orb3117133 100 µg

MCC Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
Emerin   monoclonal antibody
MB10876 50ul

Emerin monoclonal antibody

Sign In for Pricing
View Details
Recombinant Arthrobacter chlorophenolicus SsrA-binding protein (smpB)
MBS1057888-01 0.02 mg (E-Coli)

Recombinant Arthrobacter chlorophenolicus SsrA-binding protein (smpB)

Sign In for Pricing
View Details